Products/Services Used | Details | Operation |
---|---|---|
Bacterial Expression System> | The OOs (n = 5) from each group were sampled 1, 4, and 7 d postvaccination and placed in RNAlater for gene expression studies Recombinant protein production, SDS-PAGE, and Western blot Recombinant His-tagged trout CK12a (rCK12a) (amino acid sequence: MHHHHHHFSEVPVDCCLLTTETRFPRHFKMVSYLLQTTEKGCDI- DATVFITKTGVRLCTPHPTKSKWVADYIKRLERTISL) was produced in a bacterial expression system (Escherichia coli, expression vector E3; GenScript USA), with a theoretical molecular mass of the recombinant protein of 9. | Get A Quote |
Chemokines and chemokine receptors have rapidly diversified in teleost fish but their immune functions remain unclear. We report in this study that CCL19, a chemokine known to control lymphocyte migration and compartmentalization of lymphoid tissues in mammals, diversified in salmonids leading to the presence of six CCL19-like genes named CK10a, CK10b, CK12a, CK12b, CK13a, and CK13b. Salmonid CCL19-like genes all contain the DCCL-conserved motif but share low amino acid sequence identity. CK12 (but not CK10 or CK13) is constitutively expressed at high levels in all four trout MALT. Nasal vaccination with a live attenuated virus results in sustained upregulation of CK12 (but not CK10 or CK13) expre... More