| Description |
This pool includes 16 peptides derived from a peptide scan (15mers with 11 aa overlap) through the entire Envelope small membrane protein (Protein ID: P0DTC4) of SARS-CoV-2 (Severe Acute Respiratory Syndrome-related coronavirus 2) for T cell assays. |
| Sequence |
MYSFVSEETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPSFYVYS
RVKNLNSSRVPDLLV |
| Purity |
Crude |
| Solubility |
Dissolve in a minimum amount of pure DMSO (approx. 40 µl) and dilute with PBS buffer to the final concentration. Please note that the final concentration of DMSO must be below 1 % (v/v) to avoid toxicity in the biological system.
|
| Form |
Lyophilized |
| Storage |
Store at -20°C. |
| Note |
The peptides of this product are supplied as trifluoroacetate salts |
|
T-cell assays, Immune monitoring, Antigen specific T-cell stimulation, T-cell expansion, Cellular immune response
|
Please note that we do not provide HPLC and MS reports for each individual peptide within our peptide library products.
