Products/Services Used | Details | Operation |
---|---|---|
Gene Synthesis> | … YAKKVEGDMYESANSRDEYYHLLAEKIYKIQKELEEKRRSRL The human MED15 KIX cDNA encoding the amino acids 1 through 78 was synthesized by GenScript USA, Inc. and cloned into the pET-15b plasmid (Novagen, EMD Millipore) using the Nde1 and Xho1 cloning sites … | Get A Quote |
Mammalian Expression System> | Get A Quote |
The GACKIX activator binding domain has been a compelling target for small-molecule probe discovery because of the central role of activator-GACKIX complexes in diseases ranging from leukemia to memory disorders. Additionally, GACKIX is an ideal model to dissect the context-dependent function of activator-coactivator complexes. However, the dynamic and transient protein-protein interactions (PPIs) formed by GACKIX are difficult targets for small molecules. An additional complication is that activator-binding motifs, such as GACKIX, are found in multiple coactivators, making specificity difficult to attain. In this study, we demonstrate that the strategy of tethering can be used to rapidly discover h... More