Products/Services Used | Details | Operation |
---|---|---|
Catalog Peptides> | the supernatant was incubated with antibodies against Qki-5 (immunizing rabbit with a short synthetic peptide [CGAVATKVRRHDMRVHPYQRIVTADRAATGN]; GenScript) | Get A Quote |
Myelination depends on timely, precise control of oligodendrocyte differentiation and myelinogenesis. Cholesterol is the most abundant component of myelin and essential for myelin membrane assembly in the central nervous system. However, the underlying mechanisms of precise control of cholesterol biosynthesis in oligodendrocytes remain elusive. In the present study, we found that Qki depletion in neural stem cells or oligodendrocyte precursor cells in neonatal mice resulted in impaired cholesterol biosynthesis and defective myelinogenesis without compromising their differentiation into AspaGstpi myelinating oligodendrocytes. Mechanistically, Qki-5 functions as a co-activator of Srebp2 to control transcription o... More