Products/Services Used | Details | Operation |
---|---|---|
Peptide Modifications> | ...51-1,900 and 32-3,300) was purchased from Invitrogen Zymed (Carlsbad, CA). The following peptides were custom-ordered from Genscript (Piscataway, NJ): 4060 (KTSELLSGMGVSALEKEE), 4060AAAAA (KTSEAASGMGVAAAEKEE), TAT-4060 (YGRKKRRQRRRGKTSELLSGMGVSALEKEE), TAT-4060AAAA.. | Get A Quote |
Skp2 fulfills the definition of an oncoprotein with its frequent overexpression in cancer cells and oncogenic activity in various laboratory assays and therefore is a potential cancer therapy target. The best-known function of Skp2 is that of an F-box protein of the SCF(Skp2)-Roc1 E3 ubiquitin ligase targeting the cyclin-dependent kinase inhibitor p27(Kip1). Knockdown of Skp2 generally leads to accumulation of p27 but its effects on cancer cells are less certain. Another function of Skp2 is its stable interaction with cyclin A, which directly protects cyclin A from inhibition by p27 in in vitro kinase assays. Here, we report that an 18-residue blocking peptide of Skp2-cyclin A interaction can indirectly inhibit... More